DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and her4.2

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001154881.1 Gene:her4.2 / 100148329 ZFINID:ZDB-GENE-060815-1 Length:152 Species:Danio rerio


Alignment Length:159 Identity:35/159 - (22%)
Similarity:60/159 - (37%) Gaps:63/159 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHL--SKKN--------- 79
            |||:|:.||.|||..::.:|.||.: ..:..:..::.:..|:||:.:..|  |:|:         
Zfish    22 KPMVEKIRRERINSSIEKLKTLLAQ-EFIKQQPDSRQEKADILEMTLDFLRRSQKSSAAGDGRSR 85

  Fly    80 -----------CPVATPTTAPTSGVY---QSPIDCYWSGFRECVLEVSQFLQHNGYQPSFEFAKE 130
                       |||.|.:......::   |:|.|                 ||.          .
Zfish    86 CVQEAVSFLSQCPVQTQSHTRLMKLFLHMQTPAD-----------------QHT----------R 123

  Fly   131 LD-------HLVASTSKSKP---NLWRPW 149
            :|       |..:|..:..|   ::||||
Zfish   124 VDNPQTTETHANSSAKQHTPARSHIWRPW 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 16/52 (31%)
Hairy_orange 101..>116 CDD:295407 0/14 (0%)
her4.2NP_001154881.1 HLH 19..75 CDD:238036 17/53 (32%)
ORANGE 77..123 CDD:128787 9/72 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.