DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hes5.3

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_002933894.1 Gene:hes5.3 / 100101782 XenbaseID:XB-GENE-480450 Length:160 Species:Xenopus tropicalis


Alignment Length:153 Identity:40/153 - (26%)
Similarity:70/153 - (45%) Gaps:28/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KSRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKN 79
            |..:.|..::.|||:|:.||.|||..::.:::||::...| .:..:|.:..|:|||||..|.::.
 Frog    18 KLTTKQKNKIRKPMVEKMRRDRINSSINQLQNLLEKEFQL-LQPDSKPEKADILELAVKFLKQQI 81

  Fly    80 CPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFLQHNGYQPSFEFAKELDHL---------- 134
            |..:......    ||.    :..|:..|:.|...||..:..:...:. |.::|.          
 Frog    82 CSQSKNNRKD----YQD----FSQGYSNCLHETFAFLSFHRTEEEMQL-KLMNHFQCLDSQPRGI 137

  Fly   135 -VASTSKSKPN-------LWRPW 149
             |:|:.:..|.       |||||
 Frog   138 SVSSSHQKGPGPVASTKILWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 20/55 (36%)
Hairy_orange 101..>116 CDD:295407 3/14 (21%)
hes5.3XP_002933894.1 bHLH-O_HES5 26..84 CDD:381467 21/58 (36%)
Hairy_orange 93..135 CDD:383064 8/46 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.