DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hes2

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_002933889.1 Gene:hes2 / 100038090 XenbaseID:XB-GENE-486138 Length:191 Species:Xenopus tropicalis


Alignment Length:176 Identity:43/176 - (24%)
Similarity:69/176 - (39%) Gaps:57/176 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVAT 84
            :.|:..||:||::||:|||..|:.:|.|:..:...|....:|::..|:||:.|..|  ::.|   
 Frog    27 ELRKTLKPLMEKRRRARINESLNQLKTLILPLIGKDNSRYSKLEKADILEMTVRFL--RDIP--- 86

  Fly    85 PTTAPTSGVYQSPIDCYWSGFRECVLEVSQFLQHNGYQPSFEFAKELDHLVAS------------ 137
            |..|      |:|.|.|..|:|.||..:|..|..:.........:.|:||..|            
 Frog    87 PVPA------QNPADRYKEGYRACVERLSAILNKSHVLTGEASNRLLNHLQRSPELCCSDCHHPP 145

  Fly   138 -------------------------TSKSKP---------NLWRPW 149
                                     .|..:|         ::||||
 Frog   146 KSHSPRIVLHVSPRTSQLESPLLNQPSSHRPAPCPPQLNSSIWRPW 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 20/55 (36%)
Hairy_orange 101..>116 CDD:295407 6/14 (43%)
hes2XP_002933889.1 bHLH-O_HES2 25..89 CDD:381469 22/66 (33%)
Hairy_orange 97..133 CDD:369405 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.