DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HES1 and E(spl)m8-HLH

DIOPT Version :9

Sequence 1:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens
Sequence 2:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster


Alignment Length:245 Identity:50/245 - (20%)
Similarity:88/245 - (35%) Gaps:75/245 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    34 HRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTA 98
            ::|..||::|::||||:|:.|..||||:.:....|..  .:::||::||..|..:|. |:.....
  Fly    10 YQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGI--LRMDKAEMLESAVIFMRQ-QKTPKKV 71

Human    99 ALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPAL 163
            |.......|..::.|:...:|||:|.:::..|::.::...::.||......:.      |.|.|.
  Fly    72 AQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQ------QFHEAQ 130

Human   164 QAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQ 228
            .|                                                               
  Fly   131 SA--------------------------------------------------------------- 132

Human   229 FAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPW 278
             |..|.|.....|....|:..::||  ...:..||:..|......:||||
  Fly   133 -ADFIQNSMDCSSMDKAPLSPASSG--YHSDCDSPAPSPQPMQQPLWRPW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 3/9 (33%)
bHLH-O_HES1_4 33..95 CDD:381465 22/60 (37%)
Hairy_orange 110..148 CDD:400076 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 4/42 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 7/25 (28%)
WRPW motif 275..278 2/2 (100%)
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 22/59 (37%)
ORANGE 81..125 CDD:128787 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.