DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HES1 and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:266 Identity:70/266 - (26%)
Similarity:110/266 - (41%) Gaps:71/266 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNL-QRAQM 96
            ::||..||::|::||||||:.|..||.|:::.|:::....::||||||||:||.|:|.| ||..:
  Fly    10 QYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGL 74

Human    97 ----------TAALSTDPSVLGKYRAGFSECMNEVTRFL---STCEGVNTEVRTRLLGHLANCMT 148
                      :...||..:.:..:|:|:....:::|:.|   ...:.:..::...|...|....|
  Fly    75 SLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQT 139

Human   149 QINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGG--AAPPPGGAPCKLGSQAGE 211
            |:.......|.|...|                       :|...|  |.|..||    .|..|..
  Fly   140 QLLQQQQQQQQHQQQQ-----------------------IPQSSGRLAFPLLGG----YGPAAAA 177

Human   212 AAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSP----SSGPSLTAD 272
            ||..:..|                  ......:|.|      |||..||:|.    ||..|..::
  Fly   178 AAISYSSF------------------LTSKDELIDV------TSVDGNALSETASVSSQESGASE 218

Human   273 SMWRPW 278
            .:||||
  Fly   219 PVWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 31/62 (50%)
Hairy_orange 110..148 CDD:400076 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 7/44 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 13/29 (45%)
WRPW motif 275..278 2/2 (100%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.