DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and GUCA1C

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_005450.3 Gene:GUCA1C / 9626 HGNCID:4680 Length:209 Species:Homo sapiens


Alignment Length:156 Identity:48/156 - (30%)
Similarity:87/156 - (55%) Gaps:5/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRAL 89
            :|...|::.|:.:.|:||.|...|..:......:...:|....|:..||.|.||.::|.|||.|:
Human    17 QETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAV 81

  Fly    90 SITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKIFDQ 154
            ::..:..:::||.|.|:|||.|.:|.|.:.|:.::..|:..:.|||..     :|::.::.:|.:
Human    82 NLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTL-----SPEEFINLVFHK 141

  Fly   155 MDKNHDDRLTLEEFREGSKADPRIVQ 180
            :|.|:|..||||||..|...|..:::
Human   142 IDINNDGELTLEEFINGMAKDQDLLE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 48/152 (32%)
GUCA1CNP_005450.3 FRQ1 15..165 CDD:227455 48/152 (32%)
EFh 56..118 CDD:238008 22/61 (36%)
EFh 92..160 CDD:238008 27/72 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.