DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and USP32

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_011523673.1 Gene:USP32 / 84669 HGNCID:19143 Length:1634 Species:Homo sapiens


Alignment Length:108 Identity:37/108 - (34%)
Similarity:62/108 - (57%) Gaps:9/108 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMV 132
            :|..||||.|..|:|:|....||...||.|.|:..:.|:::|||.||.::|.|:.::|.|:.: |
Human   252 LFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLE-V 315

  Fly   133 GQQPQTEDENTPQKRVD--KIFDQMDKNHD----DRLTLEEFR 169
            .:..:|:|  .|:..:|  .|.:.:...||    ..||||:::
Human   316 WKDNRTDD--IPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 37/108 (34%)
USP32XP_011523673.1 EF-hand_7 252..309 CDD:290234 23/56 (41%)
EFh 253..309 CDD:238008 23/55 (42%)
EF-hand_7 286..358 CDD:290234 22/74 (30%)
UBP12 534..1346 CDD:227847
DUSP <535..602 CDD:283896
Ubiquitin_3 653..740 CDD:291502
Peptidase_C19 765..>955 CDD:271592
Peptidase_C19 <1255..1595 CDD:271592
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.