DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and CBL8

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001319319.1 Gene:CBL8 / 842756 AraportID:AT1G64480 Length:214 Species:Arabidopsis thaliana


Alignment Length:175 Identity:52/175 - (29%)
Similarity:91/175 - (52%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTTDTYFTEKEIRQWHKGFLK----DCPNGLLTEQGFIKIYKQFFPDGD-PSKFASLVFRVFDEN 75
            |.::|.||..||...|..|.|    ...:||:.::.|:   ...|.:|. .:.||..||.:||..
plant    25 LASETPFTVNEIEALHDLFKKLSTSIINDGLIHKEEFL---LALFRNGSMQNLFADRVFYMFDRK 86

  Fly    76 NDGAIEFEEFIRALSITSRGNLD-EKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTE 139
            .:|.|||.||:|:|||......: ||..:.|:|:|:...|:|...|:..:|.|   ::|:.....
plant    87 RNGVIEFGEFVRSLSIFHPYTPEHEKSAFMFKLFDLHGTGFIEPHELKKMVGA---LLGETDLEL 148

  Fly   140 DENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            .|.:.:..|::...::|.|.|.::..||::|....:|.|::.::|
plant   149 SEESIEAIVEQTMLEVDTNKDGKIDEEEWKELVAKNPSILKNMTL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 50/167 (30%)
CBL8NP_001319319.1 FRQ1 29..187 CDD:227455 49/163 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.