DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and CBL10

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_195026.1 Gene:CBL10 / 829437 AraportID:AT4G33000 Length:256 Species:Arabidopsis thaliana


Alignment Length:178 Identity:55/178 - (30%)
Similarity:96/178 - (53%) Gaps:12/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IDRLTTDTYFTEKEIRQWHKGFLK-DC---PNGLL-TEQGFIKIYKQFFPDGDPSKFASLVFRVF 72
            ::||..::.|:..|:...::.|.| .|   .:||: .|:..:.:::.  |.|: :.|...||.:|
plant    64 LERLARESQFSVNEVEALYELFKKLSCSIIDDGLIHKEELRLALFQA--PYGE-NLFLDRVFDLF 125

  Fly    73 DENNDGAIEFEEFIRALSI-TSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQP 136
            ||..:|.|||||||.|||: ....::.||..:||||||:...|:|.|||:..:|.||  ::....
plant   126 DEKKNGVIEFEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGFIEREEVQQMVSAI--LLESDM 188

  Fly   137 QTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            ...||.... .:||.|...|.:.|.:::.:|:.......|.:::.::|
plant   189 MLSDELLTM-IIDKTFADADSDKDGKISKDEWNVYVHKHPSLLKNMTL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 54/170 (32%)
CBL10NP_195026.1 EF-hand_7 81..142 CDD:290234 22/63 (35%)
EFh 118..180 CDD:238008 29/61 (48%)
EF-hand_7 118..179 CDD:290234 29/60 (48%)
EFh 154..219 CDD:238008 22/67 (33%)
EF-hand_7 158..218 CDD:290234 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.