DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and CBL3

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001320073.1 Gene:CBL3 / 828764 AraportID:AT4G26570 Length:230 Species:Arabidopsis thaliana


Alignment Length:180 Identity:52/180 - (28%)
Similarity:93/180 - (51%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTTDTYFTEKEIRQWHKGFLK----DCPNGLLTEQGF-IKIYK-----QFFPDGDPSKFASLVFR 70
            |..:|.|:..||...::.|.|    ...:||:.::.| :.::|     ..|.|    ::.|.||.
plant    36 LARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFAD----RYQSQVFD 96

  Fly    71 VFDENNDGAIEFEEFIRALSI-TSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQ 134
            :||..::|.:.||||.||||: .....:::|:.::|:|||:...|:|.|:|:..:|.|.....|.
plant    97 LFDTKHNGILGFEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGM 161

  Fly   135 QPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            ....|   ..:..:||.|::.|..||.|:..||:|......|.:::.::|
plant   162 NLSDE---IIESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLKNMTL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 51/172 (30%)
CBL3NP_001320073.1 EFh_PEF 40..202 CDD:330173 50/168 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.