DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and CBL7

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_194386.1 Gene:CBL7 / 828763 AraportID:AT4G26560 Length:214 Species:Arabidopsis thaliana


Alignment Length:187 Identity:49/187 - (26%)
Similarity:90/187 - (48%) Gaps:25/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TTDTYFTEKEIRQWHKGFLK----DCPNG--------------LLTEQGFIKIYKQFFPDGDPSK 63
            :|..:..:|:.:..::.|.|    ||...              :..||..:.|::   .|.:.|.
plant    12 STGCFTDQKKRKALYEVFKKLSGVDCQRNEGNVVEGVTCYYGEMNKEQFHVAIFQ---TDKNESL 73

  Fly    64 FASLVFRVFDENNDGAIEFEEFIRALSI-TSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDA 127
            |:..||.:||.|:||.:.||||.||||: .....:|:|:..:|:|||:...|:|.|:.:..:|.|
plant    74 FSERVFDLFDTNHDGLLGFEEFARALSVFHPSAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVA 138

  Fly   128 IYQMVGQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            .....|   .::.:...:..:||.|.|.|..|:..:..||:.:.....|.:::.::|
plant   139 TLAASG---MSQSDEIVESIIDKTFVQADTKHEGMIDEEEWMDLVFRHPLLLKNMTL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 48/179 (27%)
CBL7NP_194386.1 FRQ1 <74..186 CDD:227455 37/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.