DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and CBL6

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001328805.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:180 Identity:52/180 - (28%)
Similarity:96/180 - (53%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGF-IKIYKQFFPDGDPSKFASLVFR 70
            |::|:..| :...|.||..||...::.|.....|||:.::.| :.::|.   :...|.||..||.
plant    26 KVRQNPKD-VARGTVFTVNEIEALYELFKSISKNGLIDKEQFQLVLFKM---NTTRSLFADRVFD 86

  Fly    71 VFDENNDGAIEFEEFIRALSI-TSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQ 134
            :||..|.|.::||.|.|:||: ......::|:.::|:|||::..|||.|:|:..:|   .:.:.:
plant    87 LFDTKNTGILDFEAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMV---VRTLAE 148

  Fly   135 QPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            ......::..:..:||.|::.|...|.::..||:|......|.::|.:||
plant   149 SGMNLSDHVIESIIDKTFEEADTKLDGKIDKEEWRSLVLRHPSLLQNMSL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 48/170 (28%)
CBL6NP_001328805.1 FRQ1 38..192 CDD:227455 46/159 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.