DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and EFCAB1

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_078869.1 Gene:EFCAB1 / 79645 HGNCID:25678 Length:211 Species:Homo sapiens


Alignment Length:187 Identity:54/187 - (28%)
Similarity:95/187 - (50%) Gaps:15/187 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSKLKQDTIDRLTTD-TYFTEKEIRQWHKGFLKDCPNGL--------LTEQGFIKIYKQFFPDGD 60
            |.|..|...|.||.: .:|.:.|:....|.|. |...|:        |....|..|....|...|
Human     2 NRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFY-DLVGGVERQGLVVGLDRNAFRNILHVTFGMTD 65

  Fly    61 PSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIV 125
             ......|||.||::|||.:...|:|..||:..||:|:||:.:.|.::|::.||:|::|||::: 
Human    66 -DMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHM- 128

  Fly   126 DAIYQMVGQQPQTEDENTPQKRVDKI-FDQMDKNHDDRLTLEEFREGSKADPRIVQA 181
              :...:.:||..||.:...|.:.:| ..:||.:||.:|:..::....:.:..:::|
Human   129 --LKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 51/178 (29%)
EFCAB1NP_078869.1 EFh_PEF <48..170 CDD:330173 41/125 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.