DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Clxn

DIOPT Version :10

Sequence 1:NP_525093.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_006522537.1 Gene:Clxn / 66793 MGIID:1914043 Length:244 Species:Mus musculus


Alignment Length:115 Identity:39/115 - (33%)
Similarity:73/115 - (63%) Gaps:4/115 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMV 132
            |||.||::|||.|...|:|..||:..||.||||:.:.|.::|::.||:|::|||:::   :...:
Mouse    73 VFRGFDKDNDGCISVSEWIHGLSLFLRGTLDEKMKYCFEVFDLNGDGFISKEEMFHM---LKNSL 134

  Fly   133 GQQPQTEDENTPQKRVDKI-FDQMDKNHDDRLTLEEFREGSKADPRIVQA 181
            .:||..||.:...|.:.:| ..:||.:||.:|:..::.:..:.:..:::|
Mouse   135 LKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFVDYEKAVREENLLLEA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_525093.1 FRQ1 <69..173 CDD:444056 37/104 (36%)
ClxnXP_006522537.1 FRQ1 <67..177 CDD:444056 38/106 (36%)

Return to query results.
Submit another query.