DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Kcnip3

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_017447516.1 Gene:Kcnip3 / 65199 RGDID:70888 Length:290 Species:Rattus norvegicus


Alignment Length:189 Identity:79/189 - (41%)
Similarity:119/189 - (62%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSKLKQDTI-------DRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPS 62
            :|:|:..|:       |:|...|.||:||::..::||..:||.||:.|..|..||.||||.||.:
  Rat    98 DSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQGDAT 162

  Fly    63 KFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDA 127
            .:|..:|..||.:.:|||.||:|:..|||..||.:.|||.|||.|||::.|||||:|||..|:.:
  Rat   163 TYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKS 227

  Fly   128 IYQMVGQQ--PQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            ||.|:|:.  |... |:.|.:.|::.|.:||:|.|..:|::||.|..:.|..|:.::.|
  Rat   228 IYDMMGRHTYPILR-EDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQKDENIMSSMQL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 75/177 (42%)
Kcnip3XP_017447516.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.