DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and rcvrna

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001025419.1 Gene:rcvrna / 570333 ZFINID:ZDB-GENE-050913-106 Length:203 Species:Danio rerio


Alignment Length:187 Identity:80/187 - (42%)
Similarity:119/187 - (63%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGK-KNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKF 64
            ||. |:..|.::.::.|..:|.:||:|:..|:..|||:||:|.:|::.|..||..||||.||:.:
Zfish     1 MGNTKSGALSKELLEDLKLNTKYTEEELCAWYTSFLKECPSGRITKEQFEGIYASFFPDADPTAY 65

  Fly    65 ASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIY 129
            |..|||.||.|.||.::|:|:|.||.:||.|....||.|||.|||||.:|.|::.|:..||.:|:
Zfish    66 ARHVFRSFDTNADGTLDFKEYIVALHLTSSGKTLRKLEWAFALYDVDGNGTISKNEVQEIVRSIF 130

  Fly   130 QMVGQQPQ---TEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREG---SKADPRIVQ 180
            .||..:.|   .:|||||:||.|||:....|..:|::...||.:|   :|...|::|
Zfish   131 NMVPVEDQKNLPDDENTPEKRADKIWAFFGKQDNDKIGEGEFIQGVMENKDILRLIQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 74/174 (43%)
rcvrnaNP_001025419.1 FRQ1 13..182 CDD:227455 74/168 (44%)
EFh 65..127 CDD:238008 31/61 (51%)
EFh 101..177 CDD:238008 34/75 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.