DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Kcnip3

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001277934.1 Gene:Kcnip3 / 56461 MGIID:1929258 Length:284 Species:Mus musculus


Alignment Length:189 Identity:78/189 - (41%)
Similarity:118/189 - (62%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSKLKQDTI-------DRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPS 62
            :|:|:..|:       |:|...|.||:||::..::||..:||.||:.|..|..||.||||.||.:
Mouse    92 DSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQGDAT 156

  Fly    63 KFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDA 127
            .:|..:|..||.:.:|||.||:|:..|||..||.:.|||.|||.|||::.||.||:|||..|:.:
Mouse   157 TYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITKEEMLAIMKS 221

  Fly   128 IYQMVGQQ--PQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            ||.|:|:.  |... |:.|.:.|::.|.:||:|.|..:|::||.|..:.|..|:.::.|
Mouse   222 IYDMMGRHTYPILR-EDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQKDENIMNSMQL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 74/177 (42%)
Kcnip3NP_001277934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..57
FRQ1 109..273 CDD:227455 72/164 (44%)
EFh 158..220 CDD:238008 32/61 (52%)
EFh 194..265 CDD:238008 32/71 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.