DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:162 Identity:57/162 - (35%)
Similarity:99/162 - (61%) Gaps:9/162 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDG----DPSKFASLVFRVFDENNDGAIEFEEFI 86
            |:.:|.:.||.:||:||:|    :..:::.|.:|    :.:::|..:||..|.|.||.::|.|::
Zfish    18 ELYEWFRKFLNECPSGLIT----LHEFRRHFCNGTVGKESAEYAEQIFRTLDNNGDGVVDFREYV 78

  Fly    87 RALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQM-VGQQPQTEDENTPQKRVDK 150
            .|:|:...|:..|||.|:|:|||.|.||.|||.||..|:.|:|:| |.......|..|.::..::
Zfish    79 TAISMLIEGSTVEKLRWSFKLYDKDKDGAITRSEMLEIMQAVYKMSVAASLTKPDPLTAEECTNR 143

  Fly   151 IFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182
            ||.::||:::..::.:||.||:..|..|.:.|
Zfish   144 IFVRLDKDNNAIISQDEFIEGALNDEWIREML 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 55/156 (35%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 15/50 (30%)
EF-hand_7 32..81 CDD:290234 14/52 (27%)
EFh 56..118 CDD:238008 29/61 (48%)
EF-hand_7 57..117 CDD:290234 28/59 (47%)
EFh 92..164 CDD:238008 28/71 (39%)
EF-hand_7 93..163 CDD:290234 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.