DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and ncalda

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001107882.1 Gene:ncalda / 556178 ZFINID:ZDB-GENE-080220-28 Length:193 Species:Danio rerio


Alignment Length:183 Identity:105/183 - (57%)
Similarity:134/183 - (73%) Gaps:1/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            |||:||||:.:.:..|...|.|||.||::|:||||:|||:|.|:.:.|.|||..|||.||.||||
Zfish     1 MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGNLSMEEFKKIYGNFFPYGDASKFA 65

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ..|||.||.|.||.|:|.|||.|||:||||.|::||.|||.:||:|.:|||::.||..||.|||:
Zfish    66 EHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKSEMLEIVQAIYK 130

  Fly   131 MVGQ-QPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182
            ||.. ....|||:||:||.:|||.|||.|.|.:|:||||.:|:|.||.||:.|
Zfish   131 MVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSLEEFIKGAKTDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 95/169 (56%)
ncaldaNP_001107882.1 FRQ1 14..179 CDD:227455 95/164 (58%)
EFh <36..89 CDD:298682 31/52 (60%)
EFh 65..126 CDD:238008 36/60 (60%)
EFh 100..174 CDD:238008 41/73 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.