DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and efcab1

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001016778.1 Gene:efcab1 / 549532 XenbaseID:XB-GENE-5727529 Length:208 Species:Xenopus tropicalis


Alignment Length:191 Identity:58/191 - (30%)
Similarity:100/191 - (52%) Gaps:18/191 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKE----IRQWHKGFLKDCPNGLLTEQG-----FIKIYKQFF 56
            |.:||.:.:.|.:.||.  .:|::.|    ||.:|.  |...|....|.:|     |..|....|
 Frog     1 MNRKNLQKQADALSRLI--KHFSKNEVESLIRLYHT--LVGRPIDPNTRRGIDRNTFRNILHNTF 61

  Fly    57 PDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEM 121
            ...| ......|||.||::||..|...|::..||:..||.|:|::.:.|.:||::.||||:||||
 Frog    62 GMTD-DMIMDRVFRGFDKDNDSYISVTEWVEGLSVFLRGTLEERIKYCFGVYDLNGDGYISREEM 125

  Fly   122 YNIVDAIYQMVGQQPQTEDENTPQKRVDKI-FDQMDKNHDDRLTLEEFREGSKADPRIVQA 181
            :::   :...:.:||..||.:...|.:.:| ..:||.:||.:|:..:|.:..:.:..:::|
 Frog   126 FHM---LKNSLLKQPSEEDPDEGVKDLVEIALKKMDYDHDSKLSYMDFEKAVQEENLLLEA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 54/178 (30%)
efcab1NP_001016778.1 EF-hand_7 69..129 CDD:290234 26/62 (42%)
EFh 71..130 CDD:238008 26/61 (43%)
EFh 104..175 CDD:238008 23/73 (32%)
EF-hand_7 105..174 CDD:290234 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.