DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Hpcal4

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_059053.1 Gene:Hpcal4 / 50872 RGDID:708491 Length:191 Species:Rattus norvegicus


Alignment Length:185 Identity:102/185 - (55%)
Similarity:139/185 - (75%) Gaps:3/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            |||.||||..:.::.|..:|.|:|:|::||:||||||||:|:|..:.|.::|.:|||.||.||||
  Rat     1 MGKNNSKLAPEELEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFA 65

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ...||.||:|.||.|:|.|||.|||:||||:.::||:|||.:||:|.||.|||.||..|::|||:
  Rat    66 QHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYK 130

  Fly   131 MVG---QQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182
            |||   .....:|..|||:||||||.:||::.||::|||||:|.:|:||.||..|
  Rat   131 MVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 92/171 (54%)
Hpcal4NP_059053.1 FRQ1 13..181 CDD:227455 92/167 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.