DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and guca1d

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001011661.1 Gene:guca1d / 494573 ZFINID:ZDB-GENE-040724-231 Length:185 Species:Danio rerio


Alignment Length:184 Identity:57/184 - (30%)
Similarity:97/184 - (52%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            ||..::.|          |....| ::..|:..|:::.|:||:|......|......:.|.:.:.
Zfish     1 MGNNHASL----------DDILAE-DMHHWYNKFMRESPSGLITLFELKSILGLQGMNEDANSYV 54

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ..||..||.:.||.|:|.|:|.|:|:..:|.:::||.|.|:|:|.|.:|.|.::|:..|..||..
Zfish    55 DQVFCTFDMDRDGYIDFVEYIAAISLMLKGEINQKLKWYFKLFDQDGNGKIDKDELETIFTAIQD 119

  Fly   131 MVGQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            :...:     :..|::.|..||:::|.|.:..||||||.||:|..|.|:..|.:
Zfish   120 ITRNR-----DIVPEEIVALIFEKIDVNGEGELTLEEFIEGAKEHPEIMDMLKI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 52/168 (31%)
guca1dNP_001011661.1 EF-hand_8 28..76 CDD:290545 15/47 (32%)
EFh 53..110 CDD:238008 22/56 (39%)
EF-hand_7 56..114 CDD:290234 23/57 (40%)
EFh 89..157 CDD:238008 27/72 (38%)
EF-hand_7 90..154 CDD:290234 24/68 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.