DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and vsnl1a

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001007367.1 Gene:vsnl1a / 492494 ZFINID:ZDB-GENE-041001-211 Length:191 Species:Danio rerio


Alignment Length:185 Identity:104/185 - (56%)
Similarity:136/185 - (73%) Gaps:3/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            |||:||||..:.::.|..:|.|.|.|::||:||||||||.|.|....|.::|.:|||.||.||||
Zfish     1 MGKQNSKLTPEVMEDLVKNTEFNEHELKQWYKGFLKDCPTGRLNLDEFQQLYVKFFPYGDASKFA 65

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ...||.||:|.||.|:|.|||.||||||||:.::||:|||.:||:|.||.|||.||..|::|||:
Zfish    66 QHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYK 130

  Fly   131 MVG---QQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182
            |||   .....||..||::||||||.:||||:||:::||||:|.:|:||.||..|
Zfish   131 MVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNNDDQISLEEFKEAAKSDPSIVLLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 94/171 (55%)
vsnl1aNP_001007367.1 FRQ1 15..181 CDD:227455 94/165 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.