DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and ncaldb

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001003776.1 Gene:ncaldb / 445319 ZFINID:ZDB-GENE-040808-37 Length:192 Species:Danio rerio


Alignment Length:183 Identity:109/183 - (59%)
Similarity:133/183 - (72%) Gaps:1/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            |||:||||:.:.|..|..:|.|||.||.:|:||||:|||:|.|:...|.|||..|||.||.||||
Zfish     1 MGKQNSKLRPEVIQDLLDNTDFTEHEILEWYKGFLRDCPSGALSMDEFKKIYGNFFPYGDASKFA 65

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ..|||.||.|.||.|:|.|||.|||:||||.||:||.|||.:||:|.:|||::.||..||.|||:
Zfish    66 EHVFRTFDANGDGTIDFREFIIALSVTSRGRLDQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYK 130

  Fly   131 MVGQ-QPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182
            ||.. ....|||:||:||.||||.|||.|.|.:|:||||.||:|.||.||:.|
Zfish   131 MVSSVMKMPEDESTPEKRTDKIFRQMDTNRDGKLSLEEFVEGAKNDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 99/169 (59%)
ncaldbNP_001003776.1 FRQ1 13..179 CDD:227455 99/165 (60%)
EFh <36..89 CDD:298682 31/52 (60%)
EFh 65..126 CDD:238008 37/60 (62%)
EFh 100..174 CDD:238008 43/73 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.