DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and CG15177

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_649672.1 Gene:CG15177 / 40810 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster


Alignment Length:83 Identity:23/83 - (27%)
Similarity:38/83 - (45%) Gaps:19/83 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KFASLVFRVFDENNDGAIEFEEF-IRALSITSRGNLDEKL--------HWAFRLYDVDNDGYITR 118
            |||   |.|:|..|.|.|:.|:. :........|:.:::|        .:..:.:|||.||.|:.
  Fly   116 KFA---FEVYDTKNTGVIDREQVGVACEKFFHEGDDEDELIELRADMTEFIMKKFDVDKDGVISF 177

  Fly   119 EEMYNIVDAIYQMVGQQP 136
            |:..::       |.|||
  Fly   178 EDYSSV-------VSQQP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 23/83 (28%)
CG15177NP_649672.1 EF-hand_7 115..180 CDD:290234 19/66 (29%)
EFh 116..179 CDD:298682 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.