DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and hpca

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_957017.1 Gene:hpca / 393696 ZFINID:ZDB-GENE-040426-1683 Length:193 Species:Danio rerio


Alignment Length:183 Identity:108/183 - (59%)
Similarity:138/183 - (75%) Gaps:1/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            |||:||||:.:.:..|..:|.||:.|:::|:||||||||:|.|..:.|.|||..|||.||.||||
Zfish     1 MGKQNSKLRPEMLQDLRENTEFTDHELQEWYKGFLKDCPSGHLNVEEFKKIYANFFPYGDASKFA 65

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ..|||.||.||||.|:|.|||.|||:||||.|::||.|||.:||:|.:|||:||||..||.|||:
Zfish    66 EHVFRTFDTNNDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISREEMLEIVQAIYK 130

  Fly   131 MVGQ-QPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182
            ||.. ....|||:||:||.||||.|||.|:|.:|:||||.:|:|:||.||:.|
Zfish   131 MVSSVMKMPEDESTPEKRTDKIFRQMDLNNDGKLSLEEFIKGAKSDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 98/169 (58%)
hpcaNP_957017.1 FRQ1 13..179 CDD:227455 98/165 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.