DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and ncs1a

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001315441.1 Gene:ncs1a / 393437 ZFINID:ZDB-GENE-021220-1 Length:190 Species:Danio rerio


Alignment Length:185 Identity:132/185 - (71%)
Similarity:153/185 - (82%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            |||.|||||.:.::.|...|||||||::||:|||:||||:|.|...||.||||||||.|||:|||
Zfish     1 MGKSNSKLKPEVVEDLCRKTYFTEKEVQQWYKGFIKDCPSGQLDSSGFQKIYKQFFPFGDPTKFA 65

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            :.||.|||||.||.|||.|||:|||:||||.|||||.|||:|||:||||||||:||.||||||||
Zfish    66 TFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRDEMLNIVDAIYQ 130

  Fly   131 MVGQQPQ-TEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            |||...: .|:||||:||||:||..||||.|..|||:||:|||||||.|||||||
Zfish   131 MVGNTVELPEEENTPEKRVDRIFAMMDKNADGMLTLQEFQEGSKADPSIVQALSL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 118/169 (70%)
ncs1aNP_001315441.1 FRQ1 15..179 CDD:227455 117/163 (72%)
EFh 65..125 CDD:238008 45/59 (76%)
EFh 100..172 CDD:238008 50/71 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5906
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2877
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm6475
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.