DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Frq1

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster


Alignment Length:186 Identity:177/186 - (95%)
Similarity:183/186 - (98%) Gaps:0/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            ||||:||||||||||||||||||||||||||||||||||||||||||||||||||||.|||||||
  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            |||||||||||||:|||||||||||:||:|||||||.||||||||||||||||||||||||||||
  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130

  Fly   131 MVGQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGG 186
            |||||||:||||||||||||||||||||||.:||||||||||||||||||||||||
  Fly   131 MVGQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSLGG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 160/168 (95%)
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 160/168 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442285
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 1 0.900 - - E2759_KOG0044
Homologene 1 1.000 - - H5719
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
Isobase 1 0.950 - 0 Normalized mean entropy S161
OMA 1 1.010 - - QHG28990
OrthoDB 1 1.010 - - D112087at50557
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm6475
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R801
SonicParanoid 1 1.000 - - X31
1514.790

Return to query results.
Submit another query.