DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and CG44422

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_572699.2 Gene:CG44422 / 32063 FlyBaseID:FBgn0265595 Length:746 Species:Drosophila melanogaster


Alignment Length:180 Identity:77/180 - (42%)
Similarity:123/180 - (68%) Gaps:2/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDG-DPSKFASLVF 69
            ::.:.|::..|:..|.|||.||::.::||..:||.|::.|..|..||.||||.| :|:.:|..||
  Fly   251 ARYRPDSLSALSRATRFTEDEIKRIYRGFKAECPTGVVKEDTFKVIYSQFFPQGANPTLYAHYVF 315

  Fly    70 RVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQ 134
            ...|:::.|.:.||:|::.|||.|||:::|||.|.|.|||::.||:||||||.:||.|||:::|:
  Fly   316 NTLDQDHSGIVSFEDFVQGLSILSRGSVEEKLRWTFSLYDINGDGFITREEMTDIVTAIYELMGR 380

  Fly   135 QP-QTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALS 183
            .| :..:|...:.:|::||.:||.|.|..:|||||.|..:.|..|.:::|
  Fly   381 LPDECPEEEKIKGKVEQIFQKMDTNRDGVVTLEEFLEACRNDDAISRSMS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 75/170 (44%)
CG44422NP_572699.2 FRQ1 254..419 CDD:227455 74/164 (45%)
EFh 310..372 CDD:238008 31/61 (51%)
EFh 346..418 CDD:238008 35/71 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
77.020

Return to query results.
Submit another query.