DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and KCNIP1

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001265268.1 Gene:KCNIP1 / 30820 HGNCID:15521 Length:241 Species:Homo sapiens


Alignment Length:203 Identity:78/203 - (38%)
Similarity:119/203 - (58%) Gaps:28/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDG-------------- 59
            :.:.:::|...|.||::|::..::||..:||:|::.|..|.:||.||||.|              
Human    35 RPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGALPCLEGSPCVEFL 99

  Fly    60 -----------DPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDND 113
                       |.|.:|..:|..||....|:::||:|:.||||..||.:.|||.|.|.|||::.|
Human   100 PPSPALLFCLVDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKD 164

  Fly   114 GYITREEMYNIVDAIYQMVGQ--QPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADP 176
            |||.:|||.:||.|||.|:|:  .|..: |:||::.||..|.:||||.|..:||:||.|..:.|.
Human   165 GYINKEEMMDIVKAIYDMMGKYTYPVLK-EDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDD 228

  Fly   177 RIVQALSL 184
            .|:::|.|
Human   229 NIMRSLQL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 75/195 (38%)
KCNIP1NP_001265268.1 FRQ1 39..230 CDD:227455 75/191 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.