DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and KCNIP3

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_038462.1 Gene:KCNIP3 / 30818 HGNCID:15523 Length:256 Species:Homo sapiens


Alignment Length:189 Identity:80/189 - (42%)
Similarity:120/189 - (63%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSKLKQDTI-------DRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPS 62
            :|:|:..|:       |:|...|.||:||::..::||..:||.||:.|..|..||.||||.||.:
Human    64 DSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDAT 128

  Fly    63 KFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDA 127
            .:|..:|..||.:.:|||.||:|:..|||..||.:.|||.|||.|||::.|||||:|||..|:.:
Human   129 TYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKS 193

  Fly   128 IYQMVGQQ--PQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQALSL 184
            ||.|:|:.  |... |:.|.:.|::.|::||:|.|..:|:|||.|..:.|..|:.::.|
Human   194 IYDMMGRHTYPILR-EDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 76/177 (43%)
KCNIP3NP_038462.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
FRQ1 81..245 CDD:227455 74/164 (45%)
EFh 130..192 CDD:238008 33/61 (54%)
EFh 166..238 CDD:238008 34/72 (47%)
Interaction with KCND2. /evidence=ECO:0000250 243..256 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.