DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Efcab1

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001100400.1 Gene:Efcab1 / 301957 RGDID:1594548 Length:212 Species:Rattus norvegicus


Alignment Length:187 Identity:54/187 - (28%)
Similarity:94/187 - (50%) Gaps:14/187 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSKLKQDTIDRLTTD-TYFTEKEIR---QWHKGFLKDCPN--GLLT---EQGFIKIYKQFFPDGD 60
            |.|..|...|.||.. .:|.:.|::   ......:.|.|.  |::|   ...|..|....|...|
  Rat     2 NRKKLQKLTDTLTKSCKHFNKFEVKCLITLFYNLVGDVPEKPGVVTGLDRNVFRNILHVTFGMTD 66

  Fly    61 PSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIV 125
             ......|||.||.:|||.|...|::..||:..||.||||:.:.|.::|::.||:|::|||::: 
  Rat    67 -DMIMDRVFRGFDRDNDGCISVSEWVHGLSLFLRGTLDEKMKYCFEVFDLNGDGFISKEEMFHM- 129

  Fly   126 DAIYQMVGQQPQTEDENTPQKRVDKI-FDQMDKNHDDRLTLEEFREGSKADPRIVQA 181
              :...:.:||..||.:...|.:.:| ..:||.:||.:|:..::....:.:..:::|
  Rat   130 --LKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFVDYETAVREETLLLEA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 51/178 (29%)
Efcab1NP_001100400.1 EF-hand_7 70..130 CDD:290234 26/62 (42%)
EFh 72..131 CDD:238008 26/61 (43%)
EFh 105..168 CDD:238008 20/65 (31%)
EF-hand_7 106..175 CDD:290234 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.