DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Usp32

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_011247292.1 Gene:Usp32 / 237898 MGIID:2144475 Length:1618 Species:Mus musculus


Alignment Length:108 Identity:36/108 - (33%)
Similarity:61/108 - (56%) Gaps:9/108 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMV 132
            :|..||||.|..|:|:|....||...||.|.|:..:.|:::|||.||.::|.|:.::|.|:.: |
Mouse   236 LFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELKDMVVALLE-V 299

  Fly   133 GQQPQTEDENTPQKRVD------KIFDQMDKNHDDRLTLEEFR 169
            .:..:|:|  .|:..:|      :|.:..|......||||:::
Mouse   300 WKDNRTDD--IPELHMDLSDIVERILNAHDTTKVGHLTLEDYQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 36/108 (33%)
Usp32XP_011247292.1 FRQ1 189..339 CDD:227455 36/105 (34%)
UBP12 518..1330 CDD:227847
UCH <1248..1578 CDD:366104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.