DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Guca1a

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_032215.2 Gene:Guca1a / 14913 MGIID:102770 Length:202 Species:Mus musculus


Alignment Length:164 Identity:59/164 - (35%)
Similarity:96/164 - (58%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIRQWHKGFLKDCPNGLLTEQGFIKIYKQFF------PDGDPSKFASLVFRVFDENNDGAIEFEE 84
            |..||:|.|:.:||:|.||    :..::|||      |..  |::...:|..||.|.||.|:|.|
Mouse    17 ECHQWYKKFMTECPSGQLT----LYEFRQFFGLKNLSPSA--SQYVEQMFETFDFNKDGYIDFME 75

  Fly    85 FIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVD 149
            ::.|||:..:|.:::||.|.|:|||||.:|.|.|:|:..|:.||..:   .|.::...:.::..|
Mouse    76 YVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRTI---NPWSDSSMSAEEFTD 137

  Fly   150 KIFDQMDKNHDDRLTLEEFREGSKADPRIVQALS 183
            .:|.::|.|.|..|:||||.||.:.|..::..|:
Mouse   138 TVFAKIDINGDGELSLEEFMEGVQKDQMLLDTLT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 58/157 (37%)
Guca1aNP_032215.2 FRQ1 12..163 CDD:227455 57/154 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.