DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Rcvrn

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_543177.2 Gene:Rcvrn / 140936 RGDID:620258 Length:202 Species:Rattus norvegicus


Alignment Length:188 Identity:83/188 - (44%)
Similarity:126/188 - (67%) Gaps:8/188 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-KKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKF 64
            || .|:..|.::.::.|..:|.|||:|:..|::.|||:||:|.:|.|.|..||.:||||.||..:
  Rat     1 MGNSKSGALSKEILEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAY 65

  Fly    65 ASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIY 129
            |..|||.||.|:||.::|:|::.||.:|:.|...:||.|||.|||||.:|.|::.|:..||.||:
  Rat    66 AQHVFRSFDANSDGTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVMAIF 130

  Fly   130 QMVGQQPQ-----TEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182
            :|:  :|:     .:|||||:||.:||:....|..||:||.|||.||:.|:..|::.:
  Rat   131 KMI--KPEDVKNLPDDENTPEKRAEKIWAFFGKKDDDKLTEEEFIEGTLANKEILRLI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 78/173 (45%)
RcvrnNP_543177.2 FRQ1 14..182 CDD:227455 78/169 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.