DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and guca1a

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_571945.1 Gene:guca1a / 140430 ZFINID:ZDB-GENE-011128-5 Length:189 Species:Danio rerio


Alignment Length:175 Identity:62/175 - (35%)
Similarity:103/175 - (58%) Gaps:17/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFP----DGDPSKFASLVFRVF 72
            |:|.|..      .|:..|:|.|:.:||:|.||    :..:||||.    |...:.:...:||.|
Zfish     8 TVDDLQA------VEMHLWYKKFMTECPSGQLT----LHEFKQFFGLRGLDPKANAYIEQMFRTF 62

  Fly    73 DENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQ 137
            |.|.||.|:|.|::.|||:..||.::.||.|.|:|||||.:|.|.|.|:.||:.||..:.|.:.|
Zfish    63 DMNKDGYIDFMEYVAALSLVMRGKMEHKLRWYFKLYDVDGNGCIDRYELLNIIKAIRAINGSETQ 127

  Fly   138 TEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRIVQAL 182
               |::.::..:::|:::|.|.|..|:|:||..|:::|...::.:
Zfish   128 ---ESSAEEFTNRVFERIDINGDGELSLDEFVAGARSDEEFMEVM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 62/169 (37%)
guca1aNP_571945.1 EFh <27..76 CDD:298682 20/52 (38%)
EFh 54..116 CDD:238008 30/61 (49%)
EF-hand_7 55..115 CDD:290234 29/59 (49%)
EFh 90..160 CDD:238008 29/72 (40%)
EF-hand_7 91..157 CDD:290234 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.