DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and Gm21941

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001375392.1 Gene:Gm21941 / 100862348 MGIID:5439392 Length:166 Species:Mus musculus


Alignment Length:127 Identity:57/127 - (44%)
Similarity:77/127 - (60%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFA 65
            |.|:||||:.:.:..|.....||:.|:::|:.|||.|||.|.||...| ||...|||..|.||..
Mouse     1 MDKQNSKLRPEVLQDLQNHKEFTDHELQEWYIGFLNDCPTGHLTVDNF-KIQHNFFPYRDASKLT 64

  Fly    66 SLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDA 127
            ..||..|..|:|..|....||.|:|:||.|.|::|:.|||.:.|:|::|||:..||..||.|
Mouse    65 EHVFHTFYTNSDSTINSRVFIIAVSMTSWGKLEQKVKWAFSMSDLDSNGYISCSEMLEIVQA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 51/119 (43%)
Gm21941NP_001375392.1 FRQ1 13..>125 CDD:227455 49/112 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.