DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and si:ch211-103a14.5

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002666176.1 Gene:si:ch211-103a14.5 / 100330921 ZFINID:ZDB-GENE-091204-414 Length:192 Species:Danio rerio


Alignment Length:167 Identity:62/167 - (37%)
Similarity:97/167 - (58%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFP----DGDPSKFASLVFRVFDENNDGAIEFEEFI 86
            |..||::.|:.:||:|.||...|    |:||.    ....:::...:|:.||.|:||.|:|.|::
Zfish    16 ESHQWYRKFMTECPSGQLTFYEF----KKFFGLKNLSEKSNEYVMTMFQTFDMNDDGCIDFMEYV 76

  Fly    87 RALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKI 151
            .|||:..:|.:.:||.|.|:|||||..|.|.|||:..||.||..:.|    .|.|.:.::..:.:
Zfish    77 AALSLILKGGVQQKLRWYFKLYDVDGSGCIDREELLLIVKAIRAING----VEQEVSAEEFTNMV 137

  Fly   152 FDQMDKNHDDRLTLEEFREGSKAD----PRIVQALSL 184
            |:::|.|.|..||::||.||.:||    ..:.|:|.|
Zfish   138 FEKIDLNADGVLTMDEFMEGIQADEYLSTMLTQSLDL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 59/159 (37%)
si:ch211-103a14.5XP_002666176.1 EF-hand_8 29..79 CDD:290545 17/53 (32%)
EF-hand_7 55..112 CDD:290234 27/56 (48%)
EFh 58..116 CDD:238008 28/57 (49%)
EFh 90..159 CDD:238008 31/72 (43%)
EF-hand_7 91..158 CDD:290234 29/70 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.