DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq2 and rcvrn.1

DIOPT Version :9

Sequence 1:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002937040.1 Gene:rcvrn.1 / 100302393 XenbaseID:XB-GENE-973335 Length:202 Species:Xenopus tropicalis


Alignment Length:187 Identity:81/187 - (43%)
Similarity:125/187 - (66%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-KKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKF 64
            || .|:|.|.::.::.|..:|.|:::|:..|::.|||:||.|.:::|.|..||.:||||.||..:
 Frog     1 MGNSKSSALSKEILEELQLNTKFSQEELCTWYQSFLKECPTGRISKQQFEGIYSKFFPDADPKAY 65

  Fly    65 ASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIY 129
            |..|||.||.||||.::|:|::.||.:||.|..::||.|||.|||||.:|.|.:.|:..|:.||:
 Frog    66 ARHVFRSFDSNNDGTLDFKEYMIALHMTSSGKANQKLEWAFSLYDVDGNGTINKSEVLEIITAIF 130

  Fly   130 QMVGQQPQ---TEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREG---SKADPRIVQ 180
            :|:..:.|   .||||||::|.:||:|...|..:|:||..||.:|   :|...|::|
 Frog   131 KMINTEDQKHLPEDENTPERRTNKIWDFFGKKDNDKLTEGEFIQGIMNNKEILRLIQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 74/174 (43%)
rcvrn.1XP_002937040.1 FRQ1 14..182 CDD:227455 74/167 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.