DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and SOS3

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001190377.1 Gene:SOS3 / 832494 AraportID:AT5G24270 Length:222 Species:Arabidopsis thaliana


Alignment Length:202 Identity:60/202 - (29%)
Similarity:107/202 - (52%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDR---------LTTDTYFTEKEIRQWHKGFLK----DCPNGLLTEQGF-IKI 51
            ||...||.|:....|         |.:.|.||.:|:...::.|.|    ...:||:.::.| :.:
plant     1 MGCSVSKKKKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEEFQLAL 65

  Fly    52 YKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSV-TSKGNLDEKLQWAFRLYDVDNDGY 115
            ::.   :...:.||..:|.|||...:|.|||.||:|:|.| .....:.||:::||:|||:...|:
plant    66 FRN---RNRRNLFADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGF 127

  Fly   116 ITREEMYNIVDAIYQMVGQQPQSE---DENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPR 177
            |.|||:..:|.|:..      :||   .|:..:..|||.|.|.|:.:|||:.::|:::....:|.
plant   128 IEREELKEMVVALLH------ESELVLSEDMIEVMVDKAFVQADRKNDGKIDIDEWKDFVSLNPS 186

  Fly   178 IVQALSL 184
            :::.::|
plant   187 LIKNMTL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 55/186 (30%)
SOS3NP_001190377.1 FRQ1 29..187 CDD:227455 52/166 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 1 0.900 - - OOG6_100764
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.