DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and CBL5

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_192051.2 Gene:CBL5 / 826671 AraportID:AT4G01420 Length:203 Species:Arabidopsis thaliana


Alignment Length:185 Identity:60/185 - (32%)
Similarity:91/185 - (49%) Gaps:30/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSK----LKQDTIDRLTTDTYFTEKEIRQWHKGFLK--DC--PNGLLTEQGF----IKIYK 53
            ||...||    .:|:.|..|.:.|:|:|.|:...|..|:|  .|  .:.|||::.|    ||..|
plant     1 MGCVCSKQLEGRRQEDISLLASQTFFSEAEVEVLHGLFIKLTSCLSNDNLLTKEKFQFILIKNTK 65

  Fly    54 QFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLD-EKLQWAFRLYDVDNDGYIT 117
            :      .|..|..:|.:||..|||:|:|.||:..|::....:.. :|..:||||||....|:|.
plant    66 K------RSLSAERIFGLFDMRNDGAIDFGEFVHTLNIFHPNSSPRDKAIFAFRLYDTRETGFIE 124

  Fly   118 REEMYN-IVDAIYQMVGQQPQSE---DENTPQKRVDKIFDQMDKNHDGKLTLEEF 168
            .||:.. |:|.:       .:||   .|:.....|.|.|::.|...||.:.|||:
plant   125 PEEVKEMIIDVL-------EESELMLSESIIDSIVSKTFEEADWKKDGIIDLEEW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 56/173 (32%)
CBL5NP_192051.2 FRQ1 13..181 CDD:227455 56/173 (32%)
EFh 71..132 CDD:298682 23/60 (38%)
EFh 107..172 CDD:238008 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.