DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and vsnl1

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_031757643.1 Gene:vsnl1 / 779779 XenbaseID:XB-GENE-952045 Length:205 Species:Xenopus tropicalis


Alignment Length:185 Identity:100/185 - (54%)
Similarity:135/185 - (72%) Gaps:3/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            |||::|||..:.::.|...|.|.|.|::||:||||||||:|.|....|.::|.:|||.||.||||
 Frog    15 MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLDEFQQLYVKFFPYGDASKFA 79

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ...||.||:|.||:|:|.|||.|||:||:|:.::||.|||.:||:|.||.|||.||..|::|||:
 Frog    80 QHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYK 144

  Fly   131 MVG---QQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQAL 182
            |||   ....:||..||::||||||.:||||.|.::||:||:|.:|:||.||..|
 Frog   145 MVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 91/171 (53%)
vsnl1XP_031757643.1 FRQ1 29..195 CDD:227455 91/165 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.