DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and Ncs1

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_077342.1 Gene:Ncs1 / 65153 RGDID:68417 Length:190 Species:Rattus norvegicus


Alignment Length:188 Identity:134/188 - (71%)
Similarity:157/188 - (83%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            |||.:||||.:.::.||..|||||||::||:|||:||||:|.|...||.||||||||.|||:|||
  Rat     1 MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFA 65

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            :.||.|||||.||.|||.|||:||||||:|.|||||:|||:|||:||||||||.||.:|||||||
  Rat    66 TFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQ 130

  Fly   131 MVGQQPQ-SEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSLGGG 187
            |||...: .|:||||:||||:||..||||.||||||:||:|||||||.|||||||..|
  Rat   131 MVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 120/169 (71%)
Ncs1NP_077342.1 FRQ1 20..179 CDD:227455 117/158 (74%)
Ancestral calcium site 1 36..47 6/10 (60%)
Interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:P62166 174..190 12/15 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I5930
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5719
Inparanoid 1 1.050 277 1.000 Inparanoid score I2861
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm44992
orthoMCL 1 0.900 - - OOG6_100764
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.