DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and Kcnip3

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001277934.1 Gene:Kcnip3 / 56461 MGIID:1929258 Length:284 Species:Mus musculus


Alignment Length:187 Identity:76/187 - (40%)
Similarity:119/187 - (63%) Gaps:8/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SKLKQDTI-------DRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSK 63
            |:|:..|:       |:|...|.||:||::..::||..:||.||:.|..|..||.|||||||.:.
Mouse    93 SELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQGDATT 157

  Fly    64 FASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAI 128
            :|..:|..||.:.:|:|.||:|:..||:..:|.:.|||:|||.|||::.||.||:|||..|:.:|
Mouse   158 YAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITKEEMLAIMKSI 222

  Fly   129 YQMVGQQPQS-EDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            |.|:|:.... ..|:.|.:.|::.|.:||:|.||.:|::||.|..:.|..|:.::.|
Mouse   223 YDMMGRHTYPILREDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQKDENIMNSMQL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 72/176 (41%)
Kcnip3NP_001277934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..57
FRQ1 109..273 CDD:227455 70/163 (43%)
EFh 158..220 CDD:238008 29/61 (48%)
EFh 194..265 CDD:238008 32/70 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.