DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and usp32

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_686236.6 Gene:usp32 / 557981 ZFINID:ZDB-GENE-100210-5 Length:1585 Species:Danio rerio


Alignment Length:124 Identity:40/124 - (32%)
Similarity:69/124 - (55%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FFPQGDPSKFASL---VFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYI 116
            |.|...|...|||   :|..||||.|..|:|:|....||...:|.:.|:.::.|:::|||.||.:
Zfish   220 FVPLVSPPIHASLSEGLFHAFDENRDNHIDFKEISCGLSACCRGPVAERQKFCFKVFDVDRDGVL 284

  Fly   117 TREEMYNIVDAIYQMVGQQPQSEDENTPQ--KRVDKIFDQMDKNHD----GKLTLEEFR 169
            :|:|::.:|.|:.::   ...:..:..|:  ..|.:|.:.:.|.||    |.||||:::
Zfish   285 SRDEIHEMVVALLEV---WKDNRTDTLPEFDSSVSEIVEDILKMHDTTKQGHLTLEDYQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 40/124 (32%)
usp32XP_686236.6 EF-hand_7 236..293 CDD:290234 21/56 (38%)
EFh 237..293 CDD:238008 21/55 (38%)
EF-hand_7 270..342 CDD:290234 21/74 (28%)
EFh 270..338 CDD:298682 20/70 (29%)
DUSP <519..586 CDD:283896
UBP12 521..1546 CDD:227847
Ubiquitin_3 623..710 CDD:291502
Peptidase_C19 733..>918 CDD:271592
Peptidase_C19 <1220..1546 CDD:271592
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.