DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and LOC500007

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_006236139.1 Gene:LOC500007 / 500007 RGDID:1588445 Length:217 Species:Rattus norvegicus


Alignment Length:152 Identity:41/152 - (26%)
Similarity:83/152 - (54%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LKDCP-----NGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFDENNDGSIEFEEFIRALSVTSK 94
            |..||     |..|....|..:.:.||...: ....:.||.|||::.|..:..:|:|:.|:|..:
  Rat    35 LAGCPIGKVDNTKLDCNAFRGVLQNFFGMTN-DVLMNRVFFVFDKDGDSHVNLQEWIKGLAVFLR 98

  Fly    95 GNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQSEDENTPQKRVDKIFDQMDKNH 159
            |..:||:::.|.:|.:..|.||:||::::::.:  .:....|:.|:|...:..|:....:||.::
  Rat    99 GTFEEKMRFCFEVYYLSGDAYISREKIFDMLKS--SLFHNSPEEENEEGIKDLVEISLKKMDYDN 161

  Fly   160 DGKLTLEEFREGSKADPRIVQA 181
            |||::.|:|.:..:.|..:::|
  Rat   162 DGKISFEDFEKAVRKDGLLLEA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 40/147 (27%)
LOC500007XP_006236139.1 EFh 104..175 CDD:298682 19/72 (26%)
EF-hand_7 105..174 CDD:290234 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.