DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and guca1g

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001011660.1 Gene:guca1g / 494572 ZFINID:ZDB-GENE-050120-1 Length:187 Species:Danio rerio


Alignment Length:184 Identity:55/184 - (29%)
Similarity:108/184 - (58%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFA 65
            ||:..|..:::.:: ||        ||:..:..|:|.||:|.|....|.:|:.......:.:.:.
Zfish     1 MGQNQSDEEEEEVE-LT--------EIQPLYTRFMKVCPSGALHLHEFRRIFGVQSSSEEEALYM 56

  Fly    66 SLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQ 130
            ..:|:.||.|.|..|:|.||:.|:.:..:|||:::|:|:|::||.|.:|.:.|:|:.:::..:.:
Zfish    57 ETIFKSFDTNRDNVIDFMEFVAAVHLVLRGNLEDRLKWSFKVYDRDENGKLDRQEVIHVIRILCK 121

  Fly   131 MVGQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            :    .::....||.:..|:||:.:|:|:||:::|.||.||::.|..|:..|.|
Zfish   122 L----KKNRINMTPVEICDRIFELLDENNDGQISLSEFLEGAEKDAWIMDLLKL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 49/168 (29%)
guca1gNP_001011660.1 EF-hand_8 30..80 CDD:290545 14/49 (29%)
EFh 59..117 CDD:238008 22/57 (39%)
EFh 91..158 CDD:238008 21/70 (30%)
EF-hand_7 92..157 CDD:290234 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.