DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and kcnip1b

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_021334841.1 Gene:kcnip1b / 494089 ZFINID:ZDB-GENE-041212-57 Length:225 Species:Danio rerio


Alignment Length:178 Identity:72/178 - (40%)
Similarity:116/178 - (65%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFD 73
            :.:.:::|...|.|:::|::..::||..:||:|::.|..|..||.||||.||.|.:|..:|..||
Zfish    44 RPEGLEQLEAQTNFSKQELQVLYRGFKNECPSGVVNEDTFKHIYAQFFPHGDASTYAHYLFHAFD 108

  Fly    74 ENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQ--QP 136
            ..|:|||:||:|:..||...:|.:.:||:|.|.|||::.||:|.:|||..||.|||.|:|:  .|
Zfish   109 TRNNGSIKFEDFVMGLSTLLRGTVRDKLEWTFHLYDINKDGFINKEEMTEIVRAIYDMMGKYTYP 173

  Fly   137 QSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            ..:.: .|:..||..|::||||.||.:|||||....:.|..:::::.|
Zfish   174 ALKGD-VPKAHVDAFFEKMDKNKDGVVTLEEFVLACQEDENMMRSMQL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 71/170 (42%)
kcnip1bXP_021334841.1 FRQ1 48..205 CDD:227455 69/157 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.