DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and CG5890

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster


Alignment Length:173 Identity:67/173 - (38%)
Similarity:114/173 - (65%) Gaps:1/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSKFASLVFRVFDENND 77
            ::.|...|.||::|||..::||..:||.|::.|..|..||.:|||.|:.|.:|..||:.||.|.:
  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93

  Fly    78 GSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQP-QSEDE 141
            |:|.|.:.:..||...:|::.|:|:|.|:|||::.||.|:|.|:..|:.||::::|::| |.||:
  Fly    94 GAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDD 158

  Fly   142 NTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALSL 184
            ...:.:||::|.::|.|.||.:|:|||.|....|..:.::|.:
  Fly   159 RKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 66/165 (40%)
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 65/162 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442284
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
87.990

Return to query results.
Submit another query.