DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and CG7646

DIOPT Version :9

Sequence 1:NP_001033853.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster


Alignment Length:185 Identity:82/185 - (44%)
Similarity:121/185 - (65%) Gaps:2/185 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKSSK--LKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPQGDPSK 63
            ||..|||  |.::.::.|.|.|.:.|..|::|:|||.:|||||.||...|:.:||.|||.|:..:
  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65

  Fly    64 FASLVFRVFDENNDGSIEFEEFIRALSVTSKGNLDEKLQWAFRLYDVDNDGYITREEMYNIVDAI 128
            |...|||.||.:.:|.|:|:||:.|:.|||.|..:|||:||||:||||.:|.|..:||..||.||
  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130

  Fly   129 YQMVGQQPQSEDENTPQKRVDKIFDQMDKNHDGKLTLEEFREGSKADPRIVQALS 183
            |.|:|....:...::.::|...||.:||:|:||:||.:||.:|...|..:.:.|:
  Fly   131 YDMLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_001033853.1 FRQ1 9..178 CDD:227455 75/168 (45%)
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 74/159 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442274
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 1 0.900 - - E2759_KOG0044
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112087at50557
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
109.900

Return to query results.
Submit another query.